Protein Info for AO353_03470 in Pseudomonas fluorescens FW300-N2E3

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR01078: arginine deiminase" amino acids 10 to 416 (407 residues), 543.4 bits, see alignment E=1.5e-167 PF02274: ADI" amino acids 38 to 413 (376 residues), 471 bits, see alignment E=2.9e-145 PF19420: DDAH_eukar" amino acids 158 to 412 (255 residues), 24.9 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 82% identical to ARCA_PSEAE: Arginine deiminase (arcA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 95% identity to pba:PSEBR_a1198)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZE9 at UniProt or InterPro

Protein Sequence (418 amino acids)

>AO353_03470 arginine deiminase (Pseudomonas fluorescens FW300-N2E3)
MTTEKVKYGVHSEAGKLRKVMVCSPGLAHQRLTPNNCDELLFDDVLWVAQAKRDHFDFVT
KMRERDIDVLEMHNLLTDIVANPEALGWILQRKITANSVGVGLVHEVDAWLRSLEPRKIA
EFLIGGVSADDLPNSFGGKTIEMFRDFLGHSSFILPPLPNTQFTRDTTCWIYGGVTLNPM
HWPARRQETLLASAIYKFHPEFTNADFQVWYGDPDQEHGNATLEGGDVMPIGNGVVLIGM
GERTSRQAIGQLALNLFKHKAVERVIVAGLPKSRAAMHLDTVFSFCDRDLVTIFPEVVSQ
IVAFTLRPDESKPGGIDIRREETSFLDTVAAALNLKALRVVETGGNSFAAEREQWDDGNN
VVALEPGVVIGYDRNTYTNTLLRKAGVEVITISASELGRGRGGGHCMTCPIIRDPIDY