Protein Info for AO353_03430 in Pseudomonas fluorescens FW300-N2E3

Annotation: methylglyoxal synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR00160: methylglyoxal synthase" amino acids 14 to 153 (140 residues), 181.2 bits, see alignment E=5.3e-58 PF02142: MGS" amino acids 29 to 120 (92 residues), 57.4 bits, see alignment E=6.7e-20

Best Hits

Swiss-Prot: 58% identical to MGSA_PECCP: Methylglyoxal synthase (mgsA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 88% identity to pfl:PFL_4624)

MetaCyc: 55% identical to methylglyoxal synthase (Escherichia coli K-12 substr. MG1655)
Methylglyoxal synthase. [EC: 4.2.3.3]

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VQB3 at UniProt or InterPro

Protein Sequence (154 amino acids)

>AO353_03430 methylglyoxal synthase (Pseudomonas fluorescens FW300-N2E3)
MIGISFTQKTMAARKRIALVAHDHCKVFLLDWAERQKDKLAQHELVATGTTGMLLSKRLD
LPVESMISGPLGGDQQLGARIAEQRVDMLVFFWDPFEPQPHDPDIKALLRVAAVWNIPVA
CNECSADYLLSSPLMDQPHAYRIPDYPAYLQGRK