Protein Info for AO353_03260 in Pseudomonas fluorescens FW300-N2E3

Annotation: epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 6 to 185 (180 residues), 81.3 bits, E=2.3e-26
• PF13460: NAD_binding_10
  • amino acids 10 to 116 (107 residues), 29.3 bits, E=2.2e-10
• PF16363: GDP_Man_Dehyd
  • amino acids 37 to 174 (138 residues), 48.7 bits, E=2.4e-16
• PF01073: 3Beta_HSD
  • amino acids 41 to 126 (86 residues), 37 bits, E=5.9e-13
• PF02719: Polysacc_synt_2
  • amino acids 47 to 155 (109 residues), 23.2 bits, E=1.1e-08
• PF07993: NAD_binding_4
  • amino acids 59 to 166 (108 residues), 24.7 bits, E=3.8e-09

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfl:PFL_4587)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See A0A0N7GZE4 at UniProt or InterPro

Protein Sequence (247 amino acids)

>AO353_03260 epimerase (Pseudomonas fluorescens FW300-N2E3)
MNGLKVLLTGACGRIGKTFFEASKDRYTFTLTDRVEPGFTVNAPHRFFCLDLSDAAAVSA
ALEGIDVIVHLAGIPHATASFDELLPNNILATTYLFEASVAAGCKRLVFASSAQTIEGYP
VDRQITPGMPVMPANLYGVSKCYGEALCAFYSAKRGLSTIALRIGAFEFPDRHELTNARD
LSAWLSPRDAVQLLQRSVEVEGVQYLIGHGISNNRFKRLDLSETTRVLGYEPVDDAFQLF
DIPIAPL