Protein Info for AO353_03250 in Pseudomonas fluorescens FW300-N2E3

Annotation: gluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01313: carbohydrate kinase, thermoresistant glucokinase family
  • amino acids 8 to 168 (161 residues), 190.7 bits, E=7.6e-61
• PF13671: AAA_33
  • amino acids 9 to 137 (129 residues), 32.4 bits, E=5.5e-12

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 88% identity to pba:PSEBR_a1238)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

• D-gluconate degradation (1/1 steps found)
• sorbitol biosynthesis II (2/3 steps found)
• L-idonate degradation (1/3 steps found)
• ketogluconate metabolism (4/8 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

See A0A0N9WQG0 at UniProt or InterPro

Protein Sequence (177 amino acids)

>AO353_03250 gluconokinase (Pseudomonas fluorescens FW300-N2E3)
MSQPITALVIMGVAGCGKSSVSEALCQLSGATGIEGDTFHPAANIEKMSAGIPLNDDDRA
GWLDSLCEELRRVDASGARPVLTCSALKHSYRERLRSALPGLGFVFLELTPEVAADRVAH
RPGHFMPSTLIASQFATLESPVGEPLTLALDASKHNVDELARQAHAWWLSHGLKLAG