Protein Info for AO353_02990 in Pseudomonas fluorescens FW300-N2E3

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 17 to 156 (140 residues), 128.6 bits, E=8.4e-42

Best Hits

Swiss-Prot: 87% identical to RISB2_PSESM: 6,7-dimethyl-8-ribityllumazine synthase 2 (ribH2) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 96% identity to pba:PSEBR_a4312)

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.78

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

See A0A0N9W118 at UniProt or InterPro

Protein Sequence (169 amino acids)

>AO353_02990 6,7-dimethyl-8-ribityllumazine synthase (Pseudomonas fluorescens FW300-N2E3)
MQPTAIDSKSKNHQGERVAFIQACWHKEIVDQSRKGFVSEMIAQGYQESDIDFFEVGGAF
EIPLHAKLLAKSGRYAGIVAAGLVVDGGIYRHEFVAQSVISGLMQVQLETEVPVFSVVLT
PHHFHAGEEHQKFFFEHFVHKGQEAAKTCADTLHKMRALRRSEHRAVAV