Protein Info for AO353_02910 in Pseudomonas fluorescens FW300-N2E3

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF00072: Response_reg" amino acids 10 to 124 (115 residues), 61.4 bits, see alignment E=3.5e-20 PF13181: TPR_8" amino acids 200 to 227 (28 residues), 14.2 bits, see alignment (E = 1.7e-05) amino acids 235 to 263 (29 residues), 13.2 bits, see alignment (E = 3.4e-05) PF13432: TPR_16" amino acids 204 to 263 (60 residues), 23.8 bits, see alignment E=2.1e-08 amino acids 238 to 298 (61 residues), 29.4 bits, see alignment E=3.8e-10 PF14559: TPR_19" amino acids 209 to 275 (67 residues), 30.8 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfl:PFL_4491)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZD6 at UniProt or InterPro

Protein Sequence (534 amino acids)

>AO353_02910 chemotaxis protein CheY (Pseudomonas fluorescens FW300-N2E3)
MLAYHQKSFLIVDDFSDFRSSVRSMLRELGVKDVDTADTGEVALRMCAQKRYDFILQDYH
LGDGKKNGQQVLEDLMVEKLISHESVFLMVTAESSQAMVLSALEHEPDAYLTKPFNRAGL
AQRLERLEQRKTLLKPILQALDRGKPVEVLNACIELCKQDPRYSPLCLRYRADALRDMNQ
NEALERLYNSILADRPLPWAYVGLGRLMFKRGQIAQAKAVYEKALKAFPMMPALYDGLAD
VLVAEGDTKAAQNVLEEAVRLSPLAVRRQSLLGKLAMTNEDFEGAAKAYRQAVSQGAQSR
FKDPESNLGLAHALISKGSEKGLDTRTRLEINQTLSAVAKENINDPGLQIRARLMKATSL
LLNDAETAEKLTEQALARLDGMEQFMSAEAALLVAKQLKMLGQTDAGNSMLKNCAEIYGD
DPVVMQGIAQQTDDPAILNSGNAAADLNRQGVRSYKAGALPEARELFRGALLLQPKNISI
ALNMAQSLLHGADASLDSALLEECRTCLKMVGMMPESDARYPRYQKLRSKAFGE