Protein Info for AO353_02895 in Pseudomonas fluorescens FW300-N2E3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 354 to 371 (18 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 300 (290 residues), 83.8 bits, see alignment E=1.2e-27 amino acids 269 to 375 (107 residues), 41.1 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_4258)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VJN5 at UniProt or InterPro

Protein Sequence (462 amino acids)

>AO353_02895 MFS transporter (Pseudomonas fluorescens FW300-N2E3)
MRQILKSFRALYFASLMMLIGSGLLSTYLGLRLAADHVDSLWVGALMAANYFGLVLGGKI
GHRLIARVGHIRAYSACAGIVGAAVLGHGLIDWLPAWLVLRMVVGLGMMCQYMVIESWLN
EQAEAKQRGLVFSGYMIASYLGLVLGQLILVMHPSLGLELLMLVALCFALCLVPVALTRR
IHPAPLHPAPMEPRFFMKRVPQSLSTVLGAGLIVGSFYGLAPLYASQQGLSTEQVGLFMG
SCIFAGLLVQWPLGWLSDRYDRAVLIRSFAFCLALAALPLAIMPQVPLEVLFIAGFACSL
VQFCLYPLAVAFSNDHVEGDRRVSLTAMLLVTYGVGASIGPLVAGVLMKLFGSQMLYAFF
SFFAVVLVWRIRPKAVTNLHQVEDAPLHHVAMPDSMSSSPLVAALDPRVDEQVVHDQMQN
GASPDPDPEQDAKSEAQDTDSADEQTDDPGAERPKSFTEARP