Protein Info for AO353_02875 in Pseudomonas fluorescens FW300-N2E3

Annotation: flagellar biosynthesis protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 53 to 125 (73 residues), 69.5 bits, see alignment E=3.8e-23 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 116 to 251 (136 residues), 141.2 bits, see alignment E=1.1e-45 PF08666: SAF" amino acids 129 to 190 (62 residues), 35.1 bits, see alignment E=2.3e-12 PF13144: ChapFlgA" amino acids 129 to 251 (123 residues), 127 bits, see alignment E=6.7e-41

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 84% identity to pba:PSEBR_a4290)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQ90 at UniProt or InterPro

Protein Sequence (253 amino acids)

>AO353_02875 flagellar biosynthesis protein FlgA (Pseudomonas fluorescens FW300-N2E3)
MNTKTTFSRRLTSMCRKFLGALSAVCLLNVGSPAFADPVTLPDLLIGVTQGFLEFTVEDY
LATSQTAGRYEIEVNKLDPRMHMPACDRELTATLESPAIPLGRVTVKVRCDGVSPWTVFV
PAQVRLFREVVTTTRPLKRAGIIDPSDVMLRERDISLINQGYLTNVDQAIGQKLVRPMVS
DQVITLVHLEQAEVVRKGDQVVITARSGTLSVRMPGEALSNGGLNEQIRVKNLNSQRVIK
AQVMAPGQVEVSM