Protein Info for AO353_02620 in Pseudomonas fluorescens FW300-N2E3

Annotation: threonine-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 65% identical to COBC_PSEAE: Threonine-phosphate decarboxylase (cobC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02225, cobalamin biosynthetic protein CobC (inferred from 88% identity to pfl:PFL_4427)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
aminopropanol phosphate biosynthesis I (1/2 steps found)
superpathway of L-threonine metabolism (12/18 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VPC0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>AO353_02620 threonine-phosphate decarboxylase (Pseudomonas fluorescens FW300-N2E3)
MLEHGGRLRKAALRYGIAEADWLDLSSGLAPWPWAIPDIPLRAWARLPETDDGLEQAARE
YYGASQVLPVAGSQAAIQLLPRLRRAGKVGVLSPCYAEHAEAWRRNGYVVREVLEQEVDF
FLDSLDVLVVVNPNNPTGLSLTPERLLDWHARLAQRGGWLVVDEAFMDNTPQLSLSSYAD
QVGLIVLRSFGKFFGLAGVRLGFVLAERKLLKLLAEQVGPWAVSGPTRVLGQVCLRDTQG
HARQRLRSEEASQRLAEVLERHGFKPHGGCALFQWLVTDHAEHLHEFMARRGILLRLFTH
NSSLRFGLPADDADWQRLEHAFEAYTEETS