Protein Info for AO353_02585 in Pseudomonas fluorescens FW300-N2E3

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 329 (313 residues), 109 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfl:PFL_4420)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VPV5 at UniProt or InterPro

Protein Sequence (402 amino acids)

>AO353_02585 MFS transporter (Pseudomonas fluorescens FW300-N2E3)
MTSMWRASGWVLLGSALILALSLGVRHGFGLFLPPMSAQFGWGREVFAFAIALQNLIWGL
AQPFTGALADRFGAAKVVLVGGVLYAVGLVFMGLSDSALSLSLSAGLLIGLGLSGTSFSV
ILGVVGRALPPEKRSMGMGIASAAGSFGQFAMLPGTLGLIGWLGWSTALLVLGMLVALIV
PLVSMLKDKPLPVLGHEQTLSEALREACSHSGFWLLAFGFFVCGFQVVFIGVHLPAYLVD
QHLPASVGTTVLALIGLFNIFGTYTAGWLGGRMSKPRLLTGLYLLRAVVISLFIWAPVTQ
ASAYLFGMAMGFLWLSTVPLTNGTVATLFGVRNLSMLGGIVFLFHQLGSFLGGWLGGVVY
DRTGNYDLIWQVAILLSLLAAVLNWPVRERPVARLQAQVSAA