Protein Info for AO353_02535 in Pseudomonas fluorescens FW300-N2E3

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 275 to 301 (27 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details PF03595: SLAC1" amino acids 26 to 364 (339 residues), 321.9 bits, see alignment E=2.5e-100

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_1664)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZC7 at UniProt or InterPro

Protein Sequence (383 amino acids)

>AO353_02535 C4-dicarboxylate ABC transporter (Pseudomonas fluorescens FW300-N2E3)
MQCPNSNKTANRPLSHLQHPREAIRQFTPNWFAATMGTGVLALALAQLPVSFPGLHAFAE
GLWMFNIFLFLLFSGLYAARWAFFFDEARRIFGHSTVSMFFGTIPMGLATIINGFLLFGL
PRWGEGVVHLAEVLWWLDVAMSLACGVLIPYMMFTRQEHSIDQMTAVWLLPVVAAEVAAA
SGGLLAPHLADAHSQLVVLVTSYVLWAFSLPVAFSILTILLLRMALHKLPHENMAASSWL
ALGPIGTGALGMLLLGSDAPAIFAANGLPGIGEIAAGLGLVAGITLWGFGLWWMLIAVLI
TLRYLRGGIPFNLGWWGFTFPLGVYSLATLKLASTLNLTFFSFFGSVLVVALAIMWLIVS
KRTVQGAWRGELFVSPCIAGLAK