Protein Info for AO353_02340 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF06181: Urate_ox_N" amino acids 4 to 293 (290 residues), 411.8 bits, see alignment E=9e-128

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_1702)

Predicted SEED Role

"FIG137887: membrane protein related to purine degradation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZC3 at UniProt or InterPro

Protein Sequence (435 amino acids)

>AO353_02340 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
VEAHLLEWLNLSVRWVHMITGVAWIGASFYFVWLENNLNRVNPKNGLAGDLWAIHGGGIY
HLEKYKLAPPTMPDNLHWFKWEAYFTWMSGIALLCVVFYSNPTLYLLAPGSSLSGPEGVA
IGLGSLFIGWFIYSFLCDSALGKRPALLGFILFALIIGAAYGFSKVFSGRGAYLHVGAII
GTIMVGNVFRIIMPAQRALVAAIAENRTPDPALPAKGLLRSRHNNYFTLPVLFIMISNHF
PSTYGSQYNWLILAGIAVLAVLVRHYFNTRHESHKFAWTLPVAAVGMICLAYVTGPAPMN
TPEVAKAPAKIEYQPLPETALGGGAKPAEAAPAAPAAAAAPAQASTASGPDFSKVHSVIQ
ERCAVCHSAKPTSPLFSAAPAGVMFDTPQQIQQLAPRIQAQAVASQIMPLGNITQMTQQE
RDLIGAWINQGARTN