Protein Info for AO353_02335 in Pseudomonas fluorescens FW300-N2E3

Annotation: ureidoglycolate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04115: Ureidogly_lyase
  • amino acids 1 to 158 (158 residues), 209 bits, E=1.7e-66

Best Hits

Swiss-Prot: 98% identical to ALLA_PSEPF: Ureidoglycolate lyase (allA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 96% identity to pfs:PFLU4362)

MetaCyc: 51% identical to ureidoglycolate lyase (Escherichia coli K-12 substr. MG1655)
Ureidoglycolate lyase. [EC: 4.3.2.3]

Predicted SEED Role

"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)

MetaCyc Pathways

• superpathway of purines degradation in plants (14/18 steps found)
• allantoin degradation to glyoxylate I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)
• allantoin degradation to glyoxylate II (1/5 steps found)
• allantoin degradation to glyoxylate III (1/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.19 or 4.3.2.3

Sequence Analysis Tools

See A0A0N9W6U0 at UniProt or InterPro

Protein Sequence (167 amino acids)

>AO353_02335 ureidoglycolate hydrolase (Pseudomonas fluorescens FW300-N2E3)
MRTLTIEPLTKEAFAPFGDVIETDGSDHFMINNGSTMRFHKLATVETATPEDKAIISIFR
ADAQDMPLTVCMLERHPLGSQAFIPLLGNPFLIVVAPLGDEPVSGLVRAFVTNGRQGINY
HRGVWHHPVLTIEKRDDFLVVDRSGTGNNCDEHFFKEDERLILAPHQ