Protein Info for AO353_02270 in Pseudomonas fluorescens FW300-N2E3

Annotation: isochorismatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 24 to 193 (170 residues), 119 bits, E=1.2e-38

Best Hits

Swiss-Prot: 38% identical to YDDQ_BACSU: Uncharacterized isochorismatase family protein YddQ (yddQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 91% identity to pfs:PFLU4342)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

• superpathway of chorismate metabolism (43/59 steps found)
• 2,3-dihydroxybenzoate biosynthesis (2/3 steps found)
• enterobactin biosynthesis (5/11 steps found)
• vibriobactin biosynthesis (2/9 steps found)
• bacillibactin biosynthesis (4/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of siderophore group nonribosomal peptides

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

See A0A0N9WE67 at UniProt or InterPro

Protein Sequence (196 amino acids)

>AO353_02270 isochorismatase (Pseudomonas fluorescens FW300-N2E3)
MSVPKTMFQLSGRGYAPANLAHATLVIIDAQKEYLSGPLALSGMDAAVDNIKQLLAAARK
AGRPIVHVRHLGTVGGLFDPQGERGAFIPGLEPLADETVIGKLLPSAFHGTPLEKRLQDL
GSLDLIVCGFMSHSSVSTTVRAAKNLGFRCTLVEDACATRDLPFKGGVLSAEHVQQTEMA
IMADNFATLAQTQELI