Protein Info for AO353_02165 in Pseudomonas fluorescens FW300-N2E3

Annotation: FAD-dependent cmnm(5)s(2)U34 oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 269 to 287 (19 residues), see Phobius details PF05430: Methyltransf_30" amino acids 119 to 238 (120 residues), 137.8 bits, see alignment E=3.8e-44 TIGR03197: tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain" amino acids 269 to 663 (395 residues), 448.7 bits, see alignment E=9.9e-139 PF01266: DAO" amino acids 269 to 634 (366 residues), 167.3 bits, see alignment E=1.4e-52 PF01134: GIDA" amino acids 270 to 309 (40 residues), 21.9 bits, see alignment 1.7e-08 PF13450: NAD_binding_8" amino acids 271 to 320 (50 residues), 26.7 bits, see alignment 1.1e-09

Best Hits

Swiss-Prot: 85% identical to MNMC_PSEPF: tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein MnmC (mnmC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: None (inferred from 85% identity to pfo:Pfl01_4098)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W0M4 at UniProt or InterPro

Protein Sequence (664 amino acids)

>AO353_02165 FAD-dependent cmnm(5)s(2)U34 oxidoreductase (Pseudomonas fluorescens FW300-N2E3)
MNPETLPNPVPHAQLDWDDQGRPRSRVFDDVYFSDQSGLDETRYVFIEQNRLSERFAELP
AGERLVIGETGFGTGLNFLCAWQLFEQQAVAGARLHFISVEKYPLSPADMQRALTLWPDL
KPFADQLLAQYVAIHQGFQRLVLDNGRVTLTLLIGDVLEQLPQLDAQIDAWFLDGFAPAK
NPDMWTAELFAELARLSAPGSTISTFTSTGWVRRLLNAAGFKMRRTPGIGHKWEILRGEF
VGWPQETSAPATVKPWFARPNQLSGERRALVIGAGLAGCASAASLAARGWQVSLLERHAD
LAQEASGNPQGVLYLKLSAHGTALSQLIVSGFGHTRRLLEHLQRGVDWDDCGVLQLAFNA
KEAERQAQLAAAFPADLLHLLDQPHAQAQAGIELAHGGLFYPEGGWVHLPALCQWQASPP
NVQLLTHRDVLELRKVDDQWQAWDGETLLASAPVVVLAGAAEIKRFAHSAELPLKRIRGQ
ITRLAQTAESRCLATVVCAEGYVAPARLGEHTLGASFDFKSDDLTPTTAEHLGNLELLEE
ISSDLVTRLHARQLDPEQLQGRAAFRCTSPDYLPIVGPLADSQAFAQAYTALSKDARQVP
DIACPWLDGLYINSGHGSRGLITAPLSGELLAAWLDNEPLPLPRSVAEACHPNRFALRKL
IRGS