Protein Info for AO353_01950 in Pseudomonas fluorescens FW300-N2E3

Annotation: ion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 186 to 201 (16 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details PF00520: Ion_trans" amino acids 26 to 237 (212 residues), 111.6 bits, see alignment E=3.6e-36 PF07885: Ion_trans_2" amino acids 158 to 232 (75 residues), 57.4 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfl:PFL_1695)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPQ4 at UniProt or InterPro

Protein Sequence (274 amino acids)

>AO353_01950 ion transporter (Pseudomonas fluorescens FW300-N2E3)
MDSNDTWRKRLYVMIFHTDTVAGRRFDKTLLLIILASLVVVILDSIDDVHQNFANTLAYF
EWGFTLIFLVEYMLRLYCSPRPLRYAFSFYGLVDLLAIVPGILALYYSDAQYLLIIRIIR
MLRIFRVLKLLPYLKQAHYLLDALRGSKQKIIVFLLSVCTLVTVFGTLMYVVEGPEHGFT
SIPKGIYWAIVTLTTVGYGDIVPKTALGQVISAMVMVTGYSIIAVPTGIFTAELANAMRG
EQQQHDCPVCRKNQHEHSAAFCSRCGNALFKKIE