Protein Info for AO353_01880 in Pseudomonas fluorescens FW300-N2E3

Annotation: beta (1-6) glucans synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 393 to 414 (22 residues), see Phobius details amino acids 434 to 452 (19 residues), see Phobius details amino acids 458 to 476 (19 residues), see Phobius details amino acids 483 to 500 (18 residues), see Phobius details amino acids 506 to 526 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_1605)

Predicted SEED Role

"probable glucosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZB2 at UniProt or InterPro

Protein Sequence (531 amino acids)

>AO353_01880 beta (1-6) glucans synthase (Pseudomonas fluorescens FW300-N2E3)
MQVRCAALFPDGLTMPATSRFPFFAYLFACLLGLFALGGYWYGLGQPVLLPDVASATHKL
QCASYTPFDKDQSPFDQPFKLRPERMDADLALLATRFECIRTYSMTGLEALPDLARKHGL
KLMIGAWVNSNPVDTAKEVELLIAEANANPDVVSSVIVGNETLLRKEVTGAQLAKLINHV
KSHVKQPVTYADVWEFWLKHPEVAPAVDFLTIHLLPYWEDDPSNIDAALQHVAEVRQIFG
SRFAPKDVLIGETGWPSEGRQRETAVPSRVNEAKFIRGFVAMAEQQGWHYNLIEAFDQPW
KRASEGAVGGYWGLFDANRQDKGVLAGPVTNLPFWPQWLAVGGLIFVGTLMLGGRVRSTR
AALVLPLLGAVAACSIGTWGELARATSRFADEWIWAALLTGLNFLVLAHAALFLSARTGW
RERAFNALERRAGWLLAAAGFAGAVMMLGLVFEPRYRSFPSAALLLPALVYLIRPVSAPR
REIALLTFIIGASIAPQLYREGLFNQQAWGWALVCLLMIAALWRSLRVRNT