Protein Info for AO353_01705 in Pseudomonas fluorescens FW300-N2E3

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 95 to 114 (20 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 28 to 177 (150 residues), 89.1 bits, see alignment E=7.6e-29 PF12697: Abhydrolase_6" amino acids 29 to 273 (245 residues), 48.7 bits, see alignment E=3e-16 PF12146: Hydrolase_4" amino acids 29 to 128 (100 residues), 36.4 bits, see alignment E=7.6e-13 PF00975: Thioesterase" amino acids 31 to 186 (156 residues), 31.8 bits, see alignment E=3.5e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_4202)

Predicted SEED Role

"hydrolase, alpha/beta fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WD03 at UniProt or InterPro

Protein Sequence (283 amino acids)

>AO353_01705 alpha/beta hydrolase (Pseudomonas fluorescens FW300-N2E3)
MSSVEEVRLSLPHIELAAHLFGPEDGLPVIALHGWLDNANSFARLAPKLEGLRIVALDMA
GHGHSGHRPLGAGYALWDYAHDVLQVAEQLGWKRFALLGHSLGAIVSVVLAGALPERVTH
LALIDGVIPPTAAHDNAAERMGMALQAQLDLQEKRKPVYHTLDRAIEARMKGLVAVSREA
AELLAQRGLMPVPGGYTWRTDSRLTLASPLRLTDEQAMSFVQRISCPAQLVVAADGMLAK
HQELLERLPFSREQLPGGHHLHLNDEPGAALVADCFNRFFAVP