Protein Info for AO353_01675 in Pseudomonas fluorescens FW300-N2E3

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00072: Response_reg" amino acids 28 to 136 (109 residues), 88.7 bits, see alignment E=3e-29 PF00486: Trans_reg_C" amino acids 175 to 248 (74 residues), 85.6 bits, see alignment E=2e-28

Best Hits

Swiss-Prot: 49% identical to VIRG_AGRFC: Regulatory protein VirG (virG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 94% identity to pfl:PFL_1753)

Predicted SEED Role

"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZA7 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AO353_01675 transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MQNSPAPLNDDQKAPAAGEDKRWNTRALIVDDDVPIRELLIDYLARFNILASGVTDGAAM
RLALQAEHYDVVVLDLMLPGEDGLSLCRWLRAESDIPILMLTARCEPTDRIIGLELGADD
YMAKPFEPRELVARIQTILRRVRDDRTEQRANIRFDNWRLNSVLRQLISVDGLVVPLSNA
EFRLLWVFIERPRRVLSREQLLDAARGRSIEAFDRSIDLLVSRLRQKLGDDPKSPQLIKT
VRGEGYLFDARDIG