Protein Info for AO353_01655 in Pseudomonas fluorescens FW300-N2E3

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 321 to 332 (12 residues), see Phobius details PF00392: GntR" amino acids 15 to 76 (62 residues), 45 bits, see alignment E=1e-15 PF00155: Aminotran_1_2" amino acids 129 to 449 (321 residues), 147.2 bits, see alignment E=1.1e-46 PF12897: Asp_aminotransf" amino acids 167 to 445 (279 residues), 49 bits, see alignment E=6.3e-17

Best Hits

Predicted SEED Role

"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WBY2 at UniProt or InterPro

Protein Sequence (468 amino acids)

>AO353_01655 GntR family transcriptional regulator (Pseudomonas fluorescens FW300-N2E3)
MELRIDRQALVPVVQQIVDALAGWIRQSAIEPGTRLPSIRQLARENLLSQSSVIEAYERM
VAQGVLASRHGSGFFVAGPLDATHRCADPSGPTAADANSVGLADDPLGMLPLGRGGLPES
WRESDDLSYAIRQVSRTDMAGLFNYSPSYGLPVLRQQILKRLQQMSITVDENQVLTTTGA
THGLDLIVRTLLKPGDCVVVESPGYSNLFKLLKLHGVRLLEVPRTSRGPDIEVLEALLSA
NNPRALFINSLFHNPTGSSLAPAVAQRILQLAKRHELIIVEDDVYADFQGSAGTRLAAMD
AGQSVVYVGSFSKTLSSSLRVGYVVASAAIIARLADMKMITSLGASRFCESVLSSLLANG
AYRKLVQRQRQRLKRDMAATLLVLEDAGWEVFGKPAGGLYIWARPREHESAWVRTLAHSF
GIVLSSRTAFSPSGETIDWLRINVAYASDPRAQAFFQACALPDRLRPF