Protein Info for AO353_01565 in Pseudomonas fluorescens FW300-N2E3

Annotation: secretion system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details PF00482: T2SSF" amino acids 161 to 286 (126 residues), 82.5 bits, see alignment E=2.6e-27

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 87% identity to pba:PSEBR_a4086)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WCY6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>AO353_01565 secretion system protein (Pseudomonas fluorescens FW300-N2E3)
MNHISGEFILVFLGMVFIAVFLLSQGVVVPVFGEAGKMRKRIRGRLHVLEKANNLPNMQT
VLRQKYLTRLSPLEALLEQLPFMASLTQLIEQSGHEYRAYRVLFLGIAMGVGAGALVFLL
SSLWWMALAVAFAVAWLPLLKILRDRNKRFAEFEEGLPDALDAMCRALRAGHPFNETLRL
VAEEHKGPVAHEFGLTFADINYGNDVRRAMLGLLERMPSMTVMMLVTSILIHRETGGNLT
EVLERLSRLIRGRFRFQRKVKTLSAEGRMSAWVLVAIPFVLAAVILITSPSYLPVLTNDP
LGHKLIIGAFCAMLVGIVWIRKIIRIQV