Protein Info for AO353_01430 in Pseudomonas fluorescens FW300-N2E3

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 11 to 335 (325 residues), 225.4 bits, E=4.7e-71
• PF01565: FAD_binding_4
  • amino acids 26 to 156 (131 residues), 85.8 bits, E=2.3e-28
• PF02873: MurB_C
  • amino acids 216 to 337 (122 residues), 92.5 bits, E=1.6e-30

Best Hits

Swiss-Prot: 85% identical to MURB_PSEF5: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 85% identity to pfl:PFL_1782)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan recycling I (11/14 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

See A0A0N9W6C3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>AO353_01430 UDP-N-acetylenolpyruvoylglucosamine reductase (Pseudomonas fluorescens FW300-N2E3)
MTLHLQSQVSLKPYNSFGVDVRAQWFAEAHSDADVREALAYSAAHAVPLLVIGGGSNLLL
TADIAALVLRMATRGIRVLSDDGSQVVIEAEAGESWHPFVQWTLAQGLSGLENLSLIPGT
VGAAPMQNIGAYGVEIKDVFAGLTALDRQTGELRDFTLAECNFAYRDSLFKQQVGRWLIL
RVRFALNRVEHLHLEYGPVRQRLTEQGIDHPTATDVSQAICSIRNEKLPDPAVLGNAGSF
FKNPLVSAALAAQIRLEHPGLVGYPQADGRVKLAAGWLIEQAGWKGFRDGDAGVHRLQSL
VLVNYGTATGLELLNLAQRIQRDIAERFHVELEMEPNQY