Protein Info for AO353_01135 in Pseudomonas fluorescens FW300-N2E3

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 10 to 226 (217 residues), 105 bits, E=4.3e-34
• PF16113: ECH_2
  • amino acids 20 to 194 (175 residues), 29.4 bits, E=5.9e-11

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 96% identity to pfo:Pfl01_1744)

Predicted SEED Role

"Enoyl-CoA hydratase/isomerase family protein"

MetaCyc Pathways

• oleate β-oxidation (30/35 steps found)
• adipate degradation (5/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• valproate β-oxidation (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• phenylacetate degradation I (aerobic) (3/9 steps found)
• superpathway of phenylethylamine degradation (4/11 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

See A0A0N9W038 at UniProt or InterPro

Protein Sequence (229 amino acids)

>AO353_01135 enoyl-CoA hydratase (Pseudomonas fluorescens FW300-N2E3)
MSELISYHLEDGIATLTLSNGKVNAISPDVIAAFNAALDQAVTDRAVVIITGQPGILSGG
YDLKVMTAGPKEAVSLVTAGSTLARRLLSHPFPVIVACPGHAVAKGAFILLSADYRIGVD
GPFSIGLNEVQIGMTMHHAGIELARDRLRKSAFHRSVINAEMFDPQGAVDAGFLDKVVSA
EELQGAALAMARQLKKINMTAHKNTKLKVRKALLETLDNAIIQDQEHLV