Protein Info for AO353_01070 in Pseudomonas fluorescens FW300-N2E3

Annotation: poly(R)-hydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 93 to 113 (21 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details TIGR01838: poly(R)-hydroxyalkanoic acid synthase, class I" amino acids 49 to 567 (519 residues), 786.5 bits, see alignment E=5.4e-241 PF07167: PhaC_N" amino acids 80 to 246 (167 residues), 188.4 bits, see alignment E=9.1e-60 PF00561: Abhydrolase_1" amino acids 243 to 491 (249 residues), 77.9 bits, see alignment E=9.9e-26

Best Hits

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 74% identity to psa:PST_0683)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZ93 at UniProt or InterPro

Protein Sequence (567 amino acids)

>AO353_01070 poly(R)-hydroxyalkanoic acid synthase (Pseudomonas fluorescens FW300-N2E3)
MDNNAHTFKTYWSGQVPFIASLAVQQLRLWVSTNPWFSGHEHGAWFELPRETLDSLQADY
QAQWGQLGQQLLTGQSFSFDDRRFASGNWSEPLFGSLAAFYLLNSSFLLKLLDKLLIDDK
KPRQRLRYLVEQAIAASAPSNFLVSNPDALQRAVETKGASLITGLQHLASDMNEGKMRQC
DSGAFKVGVDLANTPGEIVFENHLFQLIQYYPQSETQYRHPVFVVPPSINKYYILDLRPD
NSMVRHLLEKGHPVFLMSWRNFDEEHAGTTWDDLIEHGVIDALQVTREISGEQRLNCVGF
CIGGTLLSTALAVLAARGDREIASVSLLTTFLDYLDTGPIDIFVDEELVAYRERTIGGMN
GPIGLFRGEDMGNTFSLLRPNDLWWNYNVDKYLKGQKPIPLDLLFWNNDSTNLPGPMYCW
YLRHTYLQNDLKSGELECCGVKLDLRAIDAPAYILATHDDHIVPWKSAYASTNLLSGTKR
FVLGASGHIAGVINPPAKQKRHYWTNNRVTKNPETWFKNAEQQPGSWWNDWFNWLAGHSG
ERQPAVAHTGNEKFPPLEPAPGSYVKQ