Protein Info for AO353_00910 in Pseudomonas fluorescens FW300-N2E3

Annotation: ATP-dependent zinc protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF05618: Zn_protease" amino acids 27 to 168 (142 residues), 153.2 bits, see alignment E=2.1e-49

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU4634)

Predicted SEED Role

"FIG008443: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VNG0 at UniProt or InterPro

Protein Sequence (179 amino acids)

>AO353_00910 ATP-dependent zinc protease (Pseudomonas fluorescens FW300-N2E3)
MRLKPFTLLICLLLCLPGLAIAGEKTVYGLNEYAQLAGIDLEVAAKLDTGAKTASLSARD
IKRFKRNGESWVRFYLAIDTAHSHPIERPLARVSKIKRRAGDFDPEEGKQYTARPVIELD
ICMGTALRSIEVNLTDRSAFQFPLLIGSEALKRFDALVDPSLKYAAGKPACAIDAHTAE