Protein Info for AO353_00755 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 360 to 391 (32 residues), see Phobius details TIGR00843: benzoate transporter" amino acids 12 to 391 (380 residues), 435.5 bits, see alignment E=9.3e-135 PF03594: BenE" amino acids 14 to 389 (376 residues), 523 bits, see alignment E=2.1e-161

Best Hits

Swiss-Prot: 43% identical to BENE_ACIAD: Benzoate membrane transport protein (benE) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05782, benzoate membrane transport protein (inferred from 96% identity to pfo:Pfl01_1792)

Predicted SEED Role

"Benzoate transport protein" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WDJ1 at UniProt or InterPro

Protein Sequence (397 amino acids)

>AO353_00755 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MTDATHAQLRPLADTSPSAIVAGFIAMMTGYTSSLVLMFQAGQAAGLTSGQISSWIWAIS
IGMAVCSISLSLRYRTPITIAWSTPGAALLITSLSGVTYGEAIGAYITCAVLVTLCGMTG
SFERLVKRIPASLAAALLAGILFKIGSEIFVAAQHRTGLVLGMFFTYLVVKRLSPRYAVL
AALLIGTALSGVMGLLDFSGFHLEVATPVWTTPHFSLAATISIGIPLFVVAMTSQNMPGI
AVLRADGYNVPASPLITTTGIASLLLAPFGSHGINLAAISAAICTGPHAHEDRNKRYTAA
VWCGIFYGIAGVFGATLAALFAALPKELVLSIAALALFGSIINGLSIAMAQVKEREAALI
TFMVTASGLTLFSIGSAFWGIVAGVITLMILNWRNAP