Protein Info for AO353_00730 in Pseudomonas fluorescens FW300-N2E3

Annotation: FAD-binding molybdopterin dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR02963: xanthine dehydrogenase, small subunit" amino acids 2 to 470 (469 residues), 706.9 bits, see alignment E=5.5e-217 PF00111: Fer2" amino acids 17 to 76 (60 residues), 27.8 bits, see alignment E=4e-10 PF01799: Fer2_2" amino acids 87 to 158 (72 residues), 96 bits, see alignment E=2.4e-31 PF00941: FAD_binding_5" amino acids 199 to 362 (164 residues), 178.9 bits, see alignment E=1.5e-56 PF03450: CO_deh_flav_C" amino acids 370 to 470 (101 residues), 125 bits, see alignment E=2.6e-40

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 92% identity to pfo:Pfl01_1797)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WCI1 at UniProt or InterPro

Protein Sequence (484 amino acids)

>AO353_00730 FAD-binding molybdopterin dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
VIQFLLNQELRSEHALDPNLTVLNYLREHLGKPGTKEGCASGDCGACTVVVGELQTDDNG
REHIRYRSLNSCLTFVSSLHGKQLISVEDLKHQGKLHSVQKAMVECHGSQCGFCTPGFVM
SLFALQKNSDHADSHKAHEALAGNLCRCTGYRPILAAAEQVCSAKQPDQFDAREAETIAR
LKAIAPTDTGELNSGDKRCLVPLTVADLADLYDAYPQAKLLAGGTDLALEVTQFHRTLPV
MIYVGNVAEMKRIERFDDRLEIGAATALSDCYDALEAEYPDFGELLQRFASLQIRNQGTL
GGNIGNASPIGDSPPLLIALGAQIVLCKGETRRTLALEDYFIDYRVTARQESEFIEKIIV
PRASAEQLFRAYKVSKRLDDDISAVCAAFNLRIENGVVADARVAFGGMAATPKRAKSCEA
ALLGAPWNNTTVERACAALAQDFTPLTDFRASKEYRLLSAQNLLRKYFIELQTPHIETRV
TAYV