Protein Info for AO353_00695 in Pseudomonas fluorescens FW300-N2E3

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 TIGR00229: PAS domain S-box protein" amino acids 3 to 120 (118 residues), 55.6 bits, see alignment E=5.9e-19 PF08448: PAS_4" amino acids 13 to 119 (107 residues), 33.1 bits, see alignment E=2.1e-11 PF00989: PAS" amino acids 13 to 101 (89 residues), 33.7 bits, see alignment E=1.1e-11 PF13426: PAS_9" amino acids 13 to 116 (104 residues), 57.5 bits, see alignment E=5e-19 PF08447: PAS_3" amino acids 25 to 110 (86 residues), 48.1 bits, see alignment E=4e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 124 to 288 (165 residues), 137.2 bits, see alignment E=4.3e-44 PF00990: GGDEF" amino acids 130 to 285 (156 residues), 152.4 bits, see alignment E=3.2e-48 PF00563: EAL" amino acids 306 to 540 (235 residues), 247.8 bits, see alignment E=3.6e-77

Best Hits

KEGG orthology group: None (inferred from 79% identity to pba:PSEBR_a1711)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7GZ84 at UniProt or InterPro

Protein Sequence (566 amino acids)

>AO353_00695 diguanylate cyclase (Pseudomonas fluorescens FW300-N2E3)
MDEKYRRAVDAAAIFSETDLAGRITYVNDLFCAVSGYSREELLGANHRILNSGLHPDDFF
TTMWRTVALGKVWKGEICNRSKDGSLNWVDSTMVPVLDESTGRVHRYLSICFDISEKRQL
LHSLQWRVGHDVLTGLPNRAYLSDLLEQALDYSRIEKVPLAVCMLDLDGFKAVNDGYGHA
SGDLLLVEVAKRLRTIVRGEDVVARLAGDEFVLILRFVRDMPELRAALHRVLEAISAPYS
ILGKDINVFASIGVTLFPVDSEDAETLLRHADQAMYVAKQSGRNRFHLFDVVRDQEVKAT
HQTVARVRQALLNDELRLHFQPKVNMRCGAVVGFEALLRWEHPQDGLVPPREFLPFVEET
DLIVDIGEWVMEQVLAQLSRWQKNGQRWPVSVNIAARHFQRADFFDRLKTVLARHAWVAP
QLLDLEIVESVAIENIQHVSTCLQACQALGVRFSLGDFGTGYSSLSYLKRLHTQTIKIDK
SFVRDILHDRDDLALTTAVIGLARAFGREVIAEGLESIEHGELLLRLGCEVAQGYFIARP
MPASEVPGWVEAFVAPTRWQTLDQAV