Protein Info for AO353_00610 in Pseudomonas fluorescens FW300-N2E3

Annotation: cytochrome C oxidase Cbb3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02433: FixO
  • amino acids 3 to 179 (177 residues), 263.2 bits, E=1.8e-82
• TIGR00781: cytochrome c oxidase, cbb3-type, subunit II
  • amino acids 4 to 179 (176 residues), 268.4 bits, E=2.9e-84

Best Hits

KEGG orthology group: K00405, cb-type cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 98% identity to pfl:PFL_1920)

MetaCyc: 94% identical to cbb3-2 cytochrome c oxidase subunit O (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See A0A0N9VNA3 at UniProt or InterPro

Protein Sequence (202 amino acids)

>AO353_00610 cytochrome C oxidase Cbb3 (Pseudomonas fluorescens FW300-N2E3)
MKHEAVEKNIGLLAFFMVIAVSIGGLTQIVPLFFQDVTNKPVEGMKPRPALELEGRDIFI
ANGCVGCHSQMIRPFRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGGRYSDDWQ
RAHLYNPRNVVPESKMPAYPFLVENKLDGKDTAKKMEVLRTLGVPYTDEDIAGAKDAVKG
KTEMDALVAYLQGLGTIIKSKR