Protein Info for AO353_00550 in Pseudomonas fluorescens FW300-N2E3

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 252 to 278 (27 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 32 to 427 (396 residues), 348.1 bits, see alignment E=3.1e-108 PF01554: MatE" amino acids 32 to 190 (159 residues), 128.4 bits, see alignment E=1.1e-41 amino acids 258 to 419 (162 residues), 129.9 bits, see alignment E=3.7e-42

Best Hits

Swiss-Prot: 68% identical to PMPM_PSEAE: Multidrug resistance protein PmpM (pmpM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 78% identity to pfo:Pfl01_3887)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VN85 at UniProt or InterPro

Protein Sequence (469 amino acids)

>AO353_00550 MATE family efflux transporter (Pseudomonas fluorescens FW300-N2E3)
VNSVTDSLAATSLNRPARVRLELKNLLGLALPIMIAQLATTAMGFVDAVMAGRVSPRDLA
AVALGNSIWIPIYLLMTGVLLATTPKIAQRFGAKQHDEIAPLARQALWLALCVGLTGSGL
LLSAEPILHWMKVDPQLIEPSMGYLHGIAFGFPGIAFYYVLRCYSDAMGRTRPSMVIGVG
GLLLNIPVNYALIYGHFGLPALGGVGCGWASGIVMWFMALSMAGWTRWAPFYAPTRVLVR
FDRPQWAVIKRLVGIGLPIGIAVFAESSIFAVIALLIGSLGSTVVAGHQIALNISSLLFM
IPYSLGMAVTVRVGQALGAGNPYQASFAAKVGLGAALVFAAFSASLILLLREPIASIYTA
DKTVIQIASMLIVYAALYQFSDAIQVICAGALRGYQDTRATMILTLFAYWGIGLPVGYVL
GLTDWFGPASGPSGLWEGLIAGLSCAALMLSIRLTRSARKRIRISRAAS