Protein Info for AO353_00430 in Pseudomonas fluorescens FW300-N2E3

Annotation: glyceraldehyde-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00044: Gp_dh_N
  • amino acids 138 to 248 (111 residues), 65.1 bits, E=6.2e-22
• TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I
  • amino acids 139 to 472 (334 residues), 368 bits, E=2.2e-114
• PF02800: Gp_dh_C
  • amino acids 303 to 460 (158 residues), 148 bits, E=1.8e-47

Best Hits

Swiss-Prot: 88% identical to GAP2_PSEAB: Glyceraldehyde-3-phosphate dehydrogenase-like protein (gap2) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 97% identity to pfo:Pfl01_3865)

Predicted SEED Role

"NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.13)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• homolactic fermentation (10/12 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• glycolysis IV (8/10 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• gluconeogenesis III (8/12 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• oxygenic photosynthesis (11/17 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12 or 1.2.1.13

Sequence Analysis Tools

See A0A0N9VN61 at UniProt or InterPro

Protein Sequence (487 amino acids)

>AO353_00430 glyceraldehyde-3-phosphate dehydrogenase (Pseudomonas fluorescens FW300-N2E3)
MWKVPVTQKPDQCLGEWIDREALAEAMIPLIGQLYRNNNVVSSIYGRSLINQSVIAILKA
HRFARHRQSDDAELSVHETFPLLKAMSELKLGAASVDLGKLAVKFKAEGKGRTAEQFVRE
ELADVVGQQNASARKGTDVVLYGFGRIGRLLARILIEKTGGGDGLRLRAIVVRKGAENDL
IKRASLLRRDSVHGPFNGTITIDEANNTITANGNLIQVIYAKNPTEVDYTQYGIKDALLV
DNTGVWRDAEGLGQHLACPGIDRVVLTAPGKGKLKNIVHGINHGEITADDKIVSAASCTT
NAIVPVLKAVNDKFGIINGHVETVHSYTNDQNLIDNFHKGDRRGRSAALNMVITETGAAT
AAAKALPELAGKLTGNAIRVPTPNVSMAILNLNLEKAATREEMNEYLRYMALHSDLHKQI
DFVNSQEVVSTDFVGSRHAGVVDAEATISQDNRVVLYVWYDNEFGYSCQVVRVMEDMAGV
NPPAFPR