Protein Info for ABZR87_RS23635 in Ralstonia sp. UNC404CL21Col

Annotation: monocarboxylate uptake permease MctP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 51 to 77 (27 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 160 to 160 (1 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 325 to 353 (29 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 430 to 448 (19 residues), see Phobius details amino acids 468 to 488 (21 residues), see Phobius details PF00474: SSF" amino acids 46 to 421 (376 residues), 73.6 bits, see alignment E=7.3e-25

Best Hits

Swiss-Prot: 71% identical to MCTP_RHIL3: Monocarboxylate transport permease protein (mctP) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 96% identity to rpf:Rpic12D_3934)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>ABZR87_RS23635 monocarboxylate uptake permease MctP (Ralstonia sp. UNC404CL21Col)
MDGQINWTALSVFIFFFALVTVLGFIASRWQRGNSDKGAHIEEWGLGGRNFGTWITWFLV
GGDFYTAYTVIAVPALVYAVGAYGFFALPYTILVYPIVFLIMPKLWKVAHANGHVTAADA
VYGRYGSRALEFAVALTGVVATMPYIALQLIGMEVVIKALGLTGELPLAAAFVILALYTY
SAGLRAPALIAFVKDIMIYIVVLVAVVLVPAKLGGYGAVFANAHDAFAIKGGATGLTLKP
AQFLPFATLAIGSALAAFMYPHTLTGIFAARSADTIRKNAVFLPAYTVLLGLIALLGFMA
YAAGIKVTNNNDVVPALFNALFPSWFTGFAFSAIAIGALVPAAVMSIGAANLFTRNFWKP
YVAPDLSHAGEEKVAKVISLIVKAGALVFILFLPTKFALDLQLLGGVWIVQTFPSVVFGL
FNISNRFRAPALLAGWAAGMIAGSWLAFSDGIKPVHTFVIGGDKYTVYTGLAALAFNIIV
AVVVQLLMGKRGEQAAALRQAG