Protein Info for ABZR87_RS23625 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 12 to 14 (3 residues), see Phobius details transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 266 to 292 (27 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 360 to 386 (27 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 194 (175 residues), 113.4 bits, see alignment E=5.6e-37 amino acids 203 to 409 (207 residues), 52.7 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: None (inferred from 88% identity to rpf:Rpic12D_3932)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>ABZR87_RS23625 MFS transporter (Ralstonia sp. UNC404CL21Col)
MQPTHANTATHQRLVLCVLSMAVLVAQIDTAVVNLAVRPIGQFFHAAVGPLQWVIDAYNL
AYAALLLSGGLLADLYGRRRAFVWGAAVFSVASVLCALAPSIGWLIGARAMAGVGASLLL
PASLAILRVVWRDARERAHALGVWAACNGLAMAIGPTAGGVLVTHFGWRAVFWVVVPVSV
AIMALAVRVVPESSDAAHRRFDALAQVLGAITLGGLAFAAIEAHQAPAVAATVLAVALIA
LTWFIRVEARHGSEALVPLELFRVRAFRGAIVATAGMTFGMYGALFLLPLMWQSTGRFSV
IGAGIALMPMALVFMAVSPLSGTVARRHGVRLATAGGVGIIALGLLTLGAFAGVASIVPA
AIGLALTGLGMGFATGPLMGAAVGAVGPERSGTASALVNVARMSGATLGVAILGAVYAVC
GSGASGLRVAMLCGGAVQLACAVVAWRHGADRR