Protein Info for ABZR87_RS23605 in Ralstonia sp. UNC404CL21Col

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 265 to 287 (23 residues), see Phobius details PF02743: dCache_1" amino acids 20 to 247 (228 residues), 65.7 bits, see alignment E=7.5e-22 PF22588: dCache_1_like" amino acids 164 to 249 (86 residues), 59.9 bits, see alignment E=3.3e-20 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 300 to 466 (167 residues), 179.3 bits, see alignment E=2.6e-57 PF00990: GGDEF" amino acids 304 to 463 (160 residues), 175.2 bits, see alignment E=1.4e-55

Best Hits

KEGG orthology group: None (inferred from 71% identity to bcj:BCAL2852)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>ABZR87_RS23605 sensor domain-containing diguanylate cyclase (Ralstonia sp. UNC404CL21Col)
MVVICAVVLYQSRLDAMARATETSRNLALLAERDIERNFELYALSLQAVVDGVNDPEVMN
ASPRLRGFALFDRAATATYLGSMLVLDAEGNIVIDSAGDVPRKANFSDRQYFKVHRDNPN
VGLYVGDPYASRLRDGAPSIPLSRRLSRPDGSFAGVVLIAIQLEYFHKLFAALSLGPHGS
VALIARDGTMVMRQPYDVKVIGRNIRNASTFKQFLLAPEGSFSDISTLDGVERLYYFKNL
PNLPLIIMVAEAHADIYAAWKHRALVIATLMAALALGFIGLSFAFAAQLRRRMRAESELA
MLARTDGLTGLNNRRTLGEILDQEWRRAKRTRSVLSLLFVDIDRFKMYNDTYGHQAGDDA
LAAVAKCIGDNIRHPSDSAARYGGEEFVVVLPDTSPEGAASIAEKIRVAIANLAIEHRAS
EYGRVTASIGAAAWTPEQDVDMSAVIRAADEALYDAKATGRNRVAQSKLMPA