Protein Info for ABZR87_RS23500 in Ralstonia sp. UNC404CL21Col

Annotation: YihY/virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 38 to 62 (25 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 147 to 173 (27 residues), see Phobius details amino acids 185 to 213 (29 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 259 to 283 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 23 to 284 (262 residues), 84.8 bits, see alignment E=4.4e-28 PF03631: Virul_fac_BrkB" amino acids 29 to 288 (260 residues), 163.9 bits, see alignment E=2.8e-52

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 83% identity to rpi:Rpic_3764)

Predicted SEED Role

"Ribonuclease I precursor (EC 3.1.27.6)" in subsystem RNA processing and degradation, bacterial (EC 3.1.27.6)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.27.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABZR87_RS23500 YihY/virulence factor BrkB family protein (Ralstonia sp. UNC404CL21Col)
MRLAACFDRALLKRSAQVLIGAVQQWSAHRAASKGAALSFYTLFSMAPVLVLVISIAGLF
FGEQAARGEIFGQIEGLVGAQGASAVEAVLAATRRSGNGLFAAVTAVALLLVGATTAFSE
LKDSLDELWDVPPRQQPGLWGLLRSRLLSFSLILVLAFLLLVSLTINAALAVVERFWGAL
WSGSASGIALLAAQVVSSAFSFAVVALLFGTIFKMLPETRVAWRDVALGAVVTALLFTLG
KHLIGLYLGNSAVASSYGAAGSVVALMLWIYYSAQIFFFGALVTRQYALQFGSRQYEAAG
RAHAAAQAALLNPALAANLSNGATTGSTASAPRDGR