Protein Info for ABZR87_RS23470 in Ralstonia sp. UNC404CL21Col

Annotation: malonate decarboxylase holo-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20866: MdcG_N
  • amino acids 7 to 81 (75 residues), 57 bits, E=1.6e-19
• TIGR03135: malonate decarboxylase holo-[acyl-carrier-protein] synthase
  • amino acids 7 to 205 (199 residues), 160.6 bits, E=2.3e-51
• PF10620: MdcG
  • amino acids 92 to 206 (115 residues), 114.7 bits, E=2.4e-37

Best Hits

Swiss-Prot: 44% identical to MDCG_PSEPU: Phosphoribosyl-dephospho-CoA transferase (mdcG) from Pseudomonas putida

KEGG orthology group: K13934, phosphoribosyl-dephospho-CoA transferase [EC: 2.7.7.66] (inferred from 86% identity to rpi:Rpic_4946)

Predicted SEED Role

"Phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.-)" in subsystem Malonate decarboxylase (EC 2.7.7.-)

MetaCyc Pathways

• malonate decarboxylase activation (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.66

Protein Sequence (211 amino acids)

>ABZR87_RS23470 malonate decarboxylase holo-ACP synthase (Ralstonia sp. UNC404CL21Col)
MTPSPLRAHDLLWVSETPVATDGAPLPDWAITACRQGAPVVVRRAPRGTDGSVPVGLRGV
ARHERCAATAAANSITRVVSPEALAATTASIAPDAPFAALRTLRALAPGLNALGWAWGPT
GGAGFALASGLPVLHAESDIDLVVRMPRAPSTAQRDQLVRLLSDTECRVDLQIDTGYGGF
ALRDWLASPHQTMLKTDHGPRLVADPWSDAA