Protein Info for ABZR87_RS23465 in Ralstonia sp. UNC404CL21Col

Annotation: malonate transporter subunit MadM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details TIGR00808: malonate transporter, MadM subunit" amino acids 1 to 252 (252 residues), 411 bits, see alignment E=1e-127 PF03818: MadM" amino acids 5 to 252 (248 residues), 399.4 bits, see alignment E=3.2e-124

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_3869)

Predicted SEED Role

"Malonate transporter, MadM subunit" in subsystem Malonate decarboxylase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ABZR87_RS23465 malonate transporter subunit MadM (Ralstonia sp. UNC404CL21Col)
MLSMLEKVLQHNGLVAAFALVGIVMGLSMWVSKKLTFGRVHGSAIAIMIGLVLAYWGGMQ
TGGERGLADLKLFGGIGLMGGAMLRDFAIVATAFEVQVTEARKAGMIGAISLLLGTVLPF
IVGACVAYAFGYTDPVSVTTIGAGAVTYIVGPVTGAALGATSDVMALSIATGLVKAILVM
VGTPFAAKALGLNNPRAAMVFGGLAGTVSGVSAGLAATDRRLVPYGSLVATFHTGLGCLL
GPSILFLATQALLR