Protein Info for ABZR87_RS23365 in Ralstonia sp. UNC404CL21Col

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 PF01627: Hpt" amino acids 12 to 96 (85 residues), 47.3 bits, see alignment E=4.2e-16 PF02518: HATPase_c" amino acids 356 to 494 (139 residues), 59.3 bits, see alignment E=9.7e-20 PF01584: CheW" amino acids 501 to 628 (128 residues), 66.9 bits, see alignment E=3e-22 PF00072: Response_reg" amino acids 655 to 767 (113 residues), 89 bits, see alignment E=4.8e-29

Best Hits

KEGG orthology group: K13490, two-component system, chemotaxis family, sensor histidine kinase and response regulator WspE (inferred from 83% identity to rsl:RPSI07_mp1757)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (776 amino acids)

>ABZR87_RS23365 hybrid sensor histidine kinase/response regulator (Ralstonia sp. UNC404CL21Col)
MSVDDDLGRQSLLALFHEEAQTQTRVLSTGLLTLERAPTDAAALEACMRAAHSLKGAARI
VGLQDGVDVAHRMEEWFVAAQRATLVLTAAHIDVLLRGTDLLLRVGQPGTAGQLPRAEVE
AVLAAFSAPERAAAAPAATTFADPDAAAEDATMKAAMALLNAEVAALSAPPVPAPEPAAP
APHRAPIGTTRDPHRMLRVRADNLDRLLSLSGESLVESRWLKPFGESMLRVKRSHRAAAL
ALDALYETLVERLDRHADADTHAALNDVRQMLGHMQQTLGEHIDDLDRFDRRSTHLAQQL
YDEALQCRMRPFGDATHAYPRVVRDLARSLGKHVRFNIVGEATQVDRDILDMLDAPLGHL
LRNAVDHGVEAPQAREAQGKPAEAAITLEARHSAGKLLITVADDGAGIDLEAVRAAVVRR
GLSDVDTASRLSDHELLDFLLLPGFSMREQVTDVSGRGVGLDAVHEMVKAVRGTVRIHNE
PGRGTRFMLQLPLTLSVIRSLLVDVGGEAYAFPLAYVRRTLELARSEIDMLEGQQHFSFE
GRPVGLVTAHQLLGTQPPGEARDSVPVVVIGEGAETYGIAVDRFLGERMLVVQPLDARLG
KVRDIAAGALMENGDAVLIVDVDDLLRSVDKLVRGGQLDKVQRAQGVAVQQRKHVLVVDD
SLTVRELERKLLEKRGYAVTVAVDGMDGWNALRGADFDLVVTDIDMPRMDGIELVTLIKR
DAALKTLPVMVVSYKDREEDRRRGLDAGADYYLAKGSFHDEALLDAVRDLIGEART