Protein Info for ABZR87_RS23360 in Ralstonia sp. UNC404CL21Col

Annotation: chemotaxis response regulator protein-glutamate methylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00072: Response_reg" amino acids 4 to 103 (100 residues), 54.1 bits, see alignment E=1.7e-18 PF01339: CheB_methylest" amino acids 152 to 328 (177 residues), 196.9 bits, see alignment E=2.3e-62

Best Hits

Swiss-Prot: 75% identical to CHEB1_BURL3: Protein-glutamate methylesterase/protein-glutamine glutaminase 1 (cheB1) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 81% identity to rsl:RPSI07_mp1756)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABZR87_RS23360 chemotaxis response regulator protein-glutamate methylesterase (Ralstonia sp. UNC404CL21Col)
MNIGIVNDMPLAVEAMRRTVARRPEHRVLWVATDGAQAVEFCAAQPPDVVLMDLIMPRFD
GVEATRRIMASRNPCAILVVTSSVGANAWRVYEAMGAGALDAVDTPTLGGPDADANHPLL
TKIDQIGRLLEKPVAPRPRIGTPGRDGAVPLVAIGASAGGPTALATVLGKLPADFAAGIA
VIQHVDQAFAAGMAEWLNGQTALTVRVAAEGDRPRAGEVLLAATNDHMHVLPGGTFGYTP
EPAGTPYRPSVDVFFHSVVEHWRGNAIGVLLTGMGRDGAIGLKAMRAKGYHTIAQDAATS
AVYGMPKAAAALDAARAILPLDRIADELITLVRA