Protein Info for ABZR87_RS23350 in Ralstonia sp. UNC404CL21Col

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 889 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details PF02743: dCache_1" amino acids 118 to 282 (165 residues), 65.2 bits, see alignment E=2e-21 TIGR00229: PAS domain S-box protein" amino acids 338 to 452 (115 residues), 59.9 bits, see alignment E=2.8e-20 PF00989: PAS" amino acids 340 to 427 (88 residues), 28.9 bits, see alignment E=3e-10 PF13426: PAS_9" amino acids 344 to 446 (103 residues), 49.9 bits, see alignment E=1e-16 PF08447: PAS_3" amino acids 356 to 427 (72 residues), 28.6 bits, see alignment E=4.3e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 456 to 618 (163 residues), 151.6 bits, see alignment E=1.6e-48 PF00990: GGDEF" amino acids 458 to 615 (158 residues), 174.8 bits, see alignment E=3.6e-55 PF00563: EAL" amino acids 636 to 871 (236 residues), 250 bits, see alignment E=6.3e-78

Best Hits

KEGG orthology group: None (inferred from 80% identity to rpf:Rpic12D_3853)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (889 amino acids)

>ABZR87_RS23350 EAL domain-containing protein (Ralstonia sp. UNC404CL21Col)
MPAEQSKASSDSTTDSPPRQGWRRELLSPLNIGAVVALLFIWSFTFHQLTQERDRLTRDA
QARTQVEAQAFGEYSLGSARRVSEFLLDLRASWLAGREVFEQVIRERQEIVRDLTFQVAV
IDENGMLLYSSIGPVTDRIDLSQREHFRVHKESGGRDVLFISDPVQGKVSKKWSIQFTRP
ILKAGQFAGVVVVSVSPEQFASFANTLAIGKDGAATIIRESGQILARVPNPTAGIEKPPR
RRQFNQPGALETGSYRVVSGTDGVERIIGYHHVPEIGLYFLVGESVASVLAPYDGYRRTA
LVEAAASTLLLALLYFTLRYQGAERRRHLEEMRLASLVYASSSEAMMVTTLDGQVVDVNP
AFTVTTGYTAQEFKGQSSDAIRSECNDGAVIDAMREGVSTRGSWSGEYLIRRKDGSEFPA
LLTVDTFADSALGEPRRVALIHDMTEKKRAEEVIWRQANFDTLTELPNRHMFYNRLRQEI
ARARQASTQLALLFIDLDRFKEVNDTLGHDQGDVLLKEIARRISAIVRGTDTVARLAGDE
FTIILPELPDAGAATPIIRALLARIAAPLQLGEESVEVSASIGVALYPRDADSAESLLVR
ADQAMFAAKSAGRNQWAVFTPALQRAEQERLRVTSDLRVALTQGQLAVHYQPIVDLLTGK
VRKAEALIRWTHPVRGEIDPADFIPVAEDSGLIVEIGKWVLNQALDQLVQWHARLDNTLQ
VSVNKSPLEFRAHLSSTESWPKVIERRGLPPHSLVVEITEGSLMADSDEVVEHLHEFRRA
GVDIALDDFGTGYSSLSYLKRFDINYIKIDQSFVRSLAHDPKDIALCSAIVSMAHALHIK
VIAEGIETEEQKAILVAAGCDYGQGHLFCPPVPPAAFEAFVVNGQLAET