Protein Info for ABZR87_RS23330 in Ralstonia sp. UNC404CL21Col

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 52 to 185 (134 residues), 29 bits, see alignment E=1.4e-10 PF12833: HTH_18" amino acids 256 to 335 (80 residues), 75.8 bits, see alignment E=4e-25 PF00165: HTH_AraC" amino acids 295 to 333 (39 residues), 28.3 bits, see alignment 2.3e-10

Best Hits

KEGG orthology group: None (inferred from 86% identity to rpf:Rpic12D_3849)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABZR87_RS23330 helix-turn-helix domain-containing protein (Ralstonia sp. UNC404CL21Col)
MKRQPKAASKRAGLHTRARIAILLPPRLFAGYVFLTQEMLLVAGTMQARSVDVMGSRLFD
IDVLSADGAAVRSFGDMPVPATAALTDAPYDVVIVPAQFAPEATLDAEEARLAEWLRRRY
DAGALVVGMNAAPLFAKAGLLDGCRATGLASERAWFARHFPDVHYTPDRPLAVDGRIITV
SGINPAVDACAYVIDHCRGAGASRRMLRTALTQSLPSYEHMAVWTAQFKRHGDAAMLAIQ
EMVERELESPPALAELAAQAAMSERTLTRRFAAATGSNLRRYVAALRLELAAFLLRTGRL
PLDHIADECGYGSVSALSRAFSAGHGCSPLQYRAQQRTR