Protein Info for ABZR87_RS23240 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF00892: EamA" amino acids 3 to 134 (132 residues), 80.3 bits, see alignment E=1.7e-26 amino acids 151 to 280 (130 residues), 69.1 bits, see alignment E=4.7e-23

Best Hits

KEGG orthology group: None (inferred from 90% identity to rpf:Rpic12D_3842)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>ABZR87_RS23240 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MPVLYPLLAVLIWAANTIVSKAAAGVVDPAAISFYRWLLAAVVLTPFCARPLWRQRRAVL
AQWRRFAVLALLGMVMYQCLAYYAAHSTSATNMGVIGALIPMLGLTLNVVVFRQPVGAQA
VTGVVVSLLGVLYLLGRGEPANLFDGGINHGDVLVLAGATAYALYNILYRRWALPFGQWI
NLYVQVLMAVVMLVPVAMTAHSVAVPAKGIGLVVFAGIASSIVASYLWMQGLKRIGSERT
AVLMNLMPVFTAGMAAVMLGETVHGYHWIGGGLVLLGVSLAQGIVRLPMGRSGLSAR