Protein Info for ABZR87_RS23225 in Ralstonia sp. UNC404CL21Col

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 349 to 366 (18 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 389 (327 residues), 135.3 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: K10544, D-xylose transport system permease protein (inferred from 94% identity to rpi:Rpic_4915)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>ABZR87_RS23225 sugar ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MSNILQSQLARQNGGSGGPRLDGRAIQQLFVRYKVLALLLAVALIWVFFYFQTNGTFLKP
NSISNLFLQMSVTGMLACGMVFVIIAGEIDLSVGSLLGLLGGLVAILTVNLGWNTWLAVG
TVLVAGAAIGVVNGFITTKLRVPSFIVGLGGMLAFRGLLQWSTDSVTIAPVPDDLGNLAQ
SFVPAWLAWSLAAVIVAGSVVLTVRRRRERARLSLSLTPMWADGLKLLAIAAASFGFVAV
LNQASGVPLPVLILLVLLAIFSYVATQTVFGRHVYAVGGNMEATRLSGVNVGRVKLLVFV
LMGLMCAFAGIITTARSAAGSPSAGVGGELDAISACFIGGTSMRGGSGTVYGALIGALVM
ASLDNGMQQMNVDASWQMIVKGVVLVVAVLIDVLSGSNRG