Protein Info for ABZR87_RS23130 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 56 to 80 (25 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 404 to 422 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 20 to 214 (195 residues), 62.5 bits, see alignment E=3.6e-21 amino acids 239 to 416 (178 residues), 39.4 bits, see alignment E=3.7e-14 PF07690: MFS_1" amino acids 23 to 282 (260 residues), 58.3 bits, see alignment E=6.4e-20 amino acids 254 to 425 (172 residues), 64.9 bits, see alignment E=6.6e-22

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 94% identity to rsl:RPSI07_mp1703)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>ABZR87_RS23130 MFS transporter (Ralstonia sp. UNC404CL21Col)
MSTLALDSRPALSRTQVIAATTIGTALEFYDFTIYSYFAIQIGQLFFPSASPVNQFLLSI
GVFGVGFVVRPLGGVIIGAYADRAGRKKAMVLTIMMMALSCALIATAPTYATAGIFAPMI
VLAARLMQGFAAGGEFGPGTTLLVEYASDRTRAFFASWNFAATALGLALGAAVATLINVT
LSKEAVLAWGWRLPFLLGIFAAPAGMLIRRRLEETLDRRDAAPSPAKPQGALKAALTTHL
KLTILGTFAELGGSVSVYITAFFLPSHAVRTLHMSPTAAVASGVVSSLVLFVAAPIAGRL
ADRYTRKRLLVTSRIIMLLAVYPAFAFLGAHPTPLALYAVSALLAVFVAAQIVPVLVMIP
ELFPKHVRATGIALTYVVSASFFGGFSPFIASWLVERTGNPLAPAWYVAAACLVSLVPVI
WLRDRTGEAL