Protein Info for ABZR87_RS23070 in Ralstonia sp. UNC404CL21Col

Annotation: 3-(3-hydroxy-phenyl)propionate transporter MhpT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 352 to 375 (24 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 260 (236 residues), 120.3 bits, see alignment E=8.9e-39 amino acids 232 to 407 (176 residues), 45.9 bits, see alignment E=4e-16 PF00083: Sugar_tr" amino acids 53 to 199 (147 residues), 60 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: K05819, MFS transporter, AAHS family, 3-hydroxyphenylpropionic acid transporter (inferred from 89% identity to rso:RS02152)

Predicted SEED Role

"3-hydroxyphenylpropionic acid transporter" in subsystem Phenylpropanoid compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>ABZR87_RS23070 3-(3-hydroxy-phenyl)propionate transporter MhpT (Ralstonia sp. UNC404CL21Col)
MQTTTTTLSRETVGPGVAMTLGLCFIVALLEGLDLQSIGVAAPRMAREFGLSVGQMGLAF
SAGTFGLLPGAMLGGRLADRIGRKRVLILATALFGIFSIATAHVWDFNSLLAIRVATGIG
LGAAMPNLIALCAEAVPARLRNTAVSVMYCGIPFGGAIAAVVGMLSAGDSGWRHIFYVGG
FGPLVVVPLLLTLQESRRFDRSFDGQQRGAIQPPPVSWALFGERRMAATLFLWVSYFFTL
IVLYFLLNWLPSLMAAQGLSRPQVGMVQILFNIGGGAGALGIGMLMDAARPRWVVSGMYV
GIIAALSLLAAAGGMASMSAGAFMAGLFVIGAQSVLYALAAAYYPTVVRGTGVGAAVAVG
RLGSIAGPLLAGQLLAMGQHATTIIGASIPVTIIAALAALLLLKRPRVQD