Protein Info for ABZR87_RS23045 in Ralstonia sp. UNC404CL21Col

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details PF01566: Nramp" amino acids 29 to 394 (366 residues), 271.9 bits, see alignment E=4.2e-85

Best Hits

KEGG orthology group: None (inferred from 88% identity to rpf:Rpic12D_3815)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>ABZR87_RS23045 Nramp family divalent metal transporter (Ralstonia sp. UNC404CL21Col)
MPAADDTPWYRRLGPGFITGAADDDPSGIATYAQAGAQVGTGMLWTLLLTLPLMIAIQLV
SARLGRVSGQGVVANIRRHHSPWLAYAFVALVTVANVINVGADIAAMGDSVRLLVGGATA
WYACLFAVVTLVLQVWMPYRRYARYLQWIALSLLAYVATAFVVKVDWAHALHDTVVPRMQ
WSKDYAMTLVAVFGTTISPYLFVWQAAGEVEETRLADDEAPLKKAPWQAKDQLARIRIDT
TVGMAVSALIAFCIMLTAAYALHTHGVTQIETCAQAAEALKPVAGRFAQMLFAVGVIGTG
LLAVPVLAGSAAYAAAEAFKWHSSLEAKVHHAPKFYLFLTLVMAAAMVMVFLPIEPFKLL
YWSAVLNGVAATPVMVMLQLMSRRKAVMGPFRSSPLLHGTAWVATLCMCASTLLFFVLAA
RGS