Protein Info for ABZR87_RS22995 in Ralstonia sp. UNC404CL21Col

Annotation: HAD-IIIA family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 14 to 159 (146 residues), 109.7 bits, E=1.2e-35
• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 15 to 161 (147 residues), 99.1 bits, E=2.3e-32
• PF13242: Hydrolase_like
  • amino acids 114 to 184 (71 residues), 59.2 bits, E=4.6e-20

Best Hits

KEGG orthology group: None (inferred from 76% identity to rpf:Rpic12D_3805)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 3.1.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (4/5 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Ascorbate and aldarate metabolism
• Glycerophospholipid metabolism
• Retinol metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Protein Sequence (222 amino acids)

>ABZR87_RS22995 HAD-IIIA family hydrolase (Ralstonia sp. UNC404CL21Col)
MALMHGPMRPQPSPAIFLDKDGTLLEDVPYNVDPARIALAPGAGDGLRLLGATGLPLIVV
SNQPGVALGYFPEHALEGVAQRLGELFALHGATLGGFYFCPHAPAADGSIQCACRKPGDG
MLRQAAAAHGITLEGSWMIGDILNDVEAGRRAGCQTILIANGNETRWQPGPLRVPDYIVG
RFDEAAAIVIAQQARHLSHVSRGSHTAPTSPTSSAHHLRAVA