Protein Info for ABZR87_RS22985 in Ralstonia sp. UNC404CL21Col

Annotation: glycosyltransferase family 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF13439: Glyco_transf_4" amino acids 22 to 202 (181 residues), 107.8 bits, see alignment E=1.9e-34 PF13579: Glyco_trans_4_4" amino acids 22 to 198 (177 residues), 102.7 bits, see alignment E=7.9e-33 PF20706: GT4-conflict" amino acids 154 to 350 (197 residues), 34.9 bits, see alignment E=2.7e-12 PF00534: Glycos_transf_1" amino acids 208 to 385 (178 residues), 136.7 bits, see alignment E=1.8e-43 PF13692: Glyco_trans_1_4" amino acids 223 to 373 (151 residues), 107.4 bits, see alignment E=2.3e-34

Best Hits

KEGG orthology group: None (inferred from 87% identity to rpi:Rpic_4880)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>ABZR87_RS22985 glycosyltransferase family 1 protein (Ralstonia sp. UNC404CL21Col)
MRIAMVSEHASPLADLGGVDCGGQNVYVRHVARQLARLGHRVDVFTRRERPWDPEVVPFD
DGCRVVHVPAGPAAVLPKEALLPHMHAFGRQLLNHCARALASGDGYDVIHANFFMSGLAS
LAASTRLHLPLVMTFHALGRVRRLHQGSADGFPDARFAIEEMLVQRADRVIAECPQDQAD
LETLYRARAEQIDVVPCGFDAAEFAPIDRAEARRRLGVPADAFVVLQLGRMVARKGVDNV
IEAIGKLPPDARKRVRLYVVGGNTVVPDVAATPELGRLQGIAERAGVSAQTTFVGKRGRA
DLRTWYSACDVFVSTPWYEPFGITPVEAMACGRAVIGADVGGIRSTVRHERTGFLVPPKD
PQALAARLLQLIQQPELCRELGQAGLVRARMLYTWLGVAGQLERAYLKAIDTHARAMGRM
TDAAPATNAAALAGLAA