Protein Info for ABZR87_RS22850 in Ralstonia sp. UNC404CL21Col

Annotation: dihydrofolate reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01872: RibD_C
  • amino acids 8 to 174 (167 residues), 42.4 bits, E=3.7e-15

Best Hits

KEGG orthology group: None (inferred from 66% identity to pbs:Plabr_1049)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Protein Sequence (186 amino acids)

>ABZR87_RS22850 dihydrofolate reductase family protein (Ralstonia sp. UNC404CL21Col)
MSKTQYYAAATLDGFIATTDHSLDWLMQFGSLEGTSYDSFIRDVGALAMGASTYEWLLRE
LAKPGPGGEAQPWPYAQPAWVFTSRTLPAVPGADIRFVRGDVQPVHRDMLAAAAGRNLWI
VGGGELAGRFLDAGLLDELIVQVMPVTLGTGLPLLPRRIVQPALKLTSAVPYKNTFVEMR
YEVVRG