Protein Info for ABZR87_RS22775 in Ralstonia sp. UNC404CL21Col

Annotation: urea ABC transporter ATP-binding protein UrtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03411: urea ABC transporter, ATP-binding protein UrtD
  • amino acids 13 to 253 (241 residues), 374.9 bits, E=9.2e-117
• PF00005: ABC_tran
  • amino acids 30 to 183 (154 residues), 98.2 bits, E=1e-31
• PF12399: BCA_ABC_TP_C
  • amino acids 230 to 253 (24 residues), 38.8 bits, see alignment (E = 8.3e-14)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 89% identity to hse:Hsero_2632)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Protein Sequence (253 amino acids)

>ABZR87_RS22775 urea ABC transporter ATP-binding protein UrtD (Ralstonia sp. UNC404CL21Col)
MTQPIGVEMPKPVLAIEDLTVSFDGFKAVDSLNLYVDRNEVRVVIGPNGAGKTTVLDLIC
GKTRATSGSIRFNNLELTKMREHDIVRSGVGRKFQTPSIYENLTVFENLEMSFPRGRKVL
GALAFRRTPDVVERVEAVARDIFLHELLHQQADLLSHGQKQWLEIGMLLMQEPELVMLDE
PVAGMSVSEREKTAELLGRISQGRSVLVIEHDMEFVKSIAHRVTVLHQGKVLAEGSMDAV
QADPKVIEVYLGH